PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

MYB

Protein Properties

Length: 180aa MW: 20802.5 Da PI: 10.9429

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.B01556.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	44.6	3.3e-14	29	74	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+W +eEde l++ v+++G+++W++I ++ + Rt+k+c++rw + Migut.B01556.1.p 29 KGPWKEEEDEVLINHVRKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 74 79***********************8887799********87 PP
2	Myb_DNA-binding	45.6	1.7e-14	85	124	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++eE+ +++ +q+G++ W++Ia +++ gRt++++k++w Migut.B01556.1.p 85 KFSAEEERTVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 124 79****************.*****.********* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-21	24	77	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.506	24	80	IPR017930	Myb domain
SuperFamily	SSF46689	1.33E-28	26	124	IPR009057	Homeodomain-like
SMART	SM00717	4.6E-11	28	78	IPR001005	SANT/Myb domain
CDD	cd00167	7.23E-11	31	76	No hit	No description
Pfam	PF13921	1.9E-12	32	82	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.7E-19	78	130	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.917	81	132	IPR017930	Myb domain
SMART	SM00717	8.7E-13	82	130	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-13	85	124	IPR001005	SANT/Myb domain
CDD	cd00167	6.80E-10	85	124	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048235	Biological Process	pollen sperm cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MESSRLCGIF SSRRRISRRH ENGDHDLRKG PWKEEEDEVL INHVRKYGPR DWSSIRSKGL 60 LQRTGKSCRL RWVNKLRPNL KNGVKFSAEE ERTVIELQAQ FGNKWARIAT YLPGRTDNDV 120 KNFWSSRQKR LARILQTSAP SSSSSSSNKS HKIIITNNAP TDPKEDEPPL VKPPSNFLHE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-29	26	130	24	126	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269\|PubMed:15618418, ECO:0000269\|PubMed:15694308, ECO:0000269\|PubMed:19300502, ECO:0000269\|PubMed:21285328, ECO:0000269\|PubMed:24876252}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.B01556.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269\|PubMed:21441434, ECO:0000269\|PubMed:25057814}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012843921.1	1e-116	PREDICTED: transcription factor MYB24
Swissprot	A0A178VEK7	7e-71	DUO1_ARATH; Transcription factor DUO1
TrEMBL	A0A022QVI5	1e-114	A0A022QVI5_ERYGU; Uncharacterized protein

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4207	23	42

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G60460.1	8e-72	MYB family protein

Link Out ? help Back to Top
Phytozome	Migut.B01556.1.p

Publications ? help Back to Top
Zheng B,He H,Zheng Y,Wu W,McCormick S An ARID domain-containing protein within nuclear bodies is required for sperm cell formation in Arabidopsis thaliana. PLoS Genet., 2014. 10(7): p. e1004421 [PMID:25057814] Peters B, et al. A Conserved cis-Regulatory Module Determines Germline Fate through Activation of the Transcription Factor DUO1 Promoter. Plant Physiol., 2017. 173(1): p. 280-293 [PMID:27624837] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145]