PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr7g028448.1 | ||||||||
Common Name | MTR_4g036915, MTR_7g028448 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 170aa MW: 19885.6 Da PI: 4.8725 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.1 | 3e-25 | 19 | 67 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+i+ snrqvtfskRr+g++KKA+EL+vLCda va+++fs+++kl+ + Medtr7g028448.1 19 KKIDKASNRQVTFSKRRQGLFKKASELCVLCDAHVAMVVFSPSDKLFCF 67 6899*****************************************9877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.0E-33 | 11 | 70 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 26.296 | 11 | 71 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.14E-28 | 12 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-21 | 13 | 33 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-25 | 20 | 67 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-21 | 33 | 48 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-21 | 48 | 69 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MNMDNQRKKS VGHKKIEIKK IDKASNRQVT FSKRRQGLFK KASELCVLCD AHVAMVVFSP 60 SDKLFCFGQP NIDTILNSYI NETTEFEDSK TSSYEEYNRR YEEALKMLES EKKKLADVQN 120 LNKSDWWNDS IDDMSIEELE QFMESIKELK TNLNEPMLCR TMEFLDLDE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3kov_B | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3kov_I | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3kov_J | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_A | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_B | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_C | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_D | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_I | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
3p57_J | 3e-18 | 12 | 93 | 1 | 81 | Myocyte-specific enhancer factor 2A |
6byy_A | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6byy_B | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6byy_C | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6byy_D | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6bz1_A | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6bz1_B | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6bz1_C | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
6bz1_D | 3e-18 | 11 | 93 | 1 | 82 | MEF2 CHIMERA |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr7g028448.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013447936.1 | 1e-122 | agamous-like MADS-box protein AGL62 | ||||
Refseq | XP_013455423.1 | 1e-122 | agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A072UI85 | 1e-121 | A0A072UI85_MEDTR; MADS-box transcription factor family protein | ||||
STRING | AES84416 | 3e-72 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 3e-35 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr7g028448.1 |
Entrez Gene | 25491923 | 25497761 |
Publications ? help Back to Top | |||
---|---|---|---|
|