![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C014426P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 62aa MW: 7115.16 Da PI: 9.0387 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 34.1 | 9.5e-11 | 21 | 61 | 2 | 42 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfd 42 +++k sk+ T++g+ d v l a++a+rf+d+qd+LG++ MELO3C014426P1 21 TARKYHCSKVFTAKGPLDHDVKLLAHTAIRFYDVQDRLGYK 61 6788899********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 12.53 | 20 | 61 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 9.8E-8 | 22 | 61 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MKTNTYDEIV LVQDSHILYS TARKYHCSKV FTAKGPLDHD VKLLAHTAIR FYDVQDRLGY 60 K* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}. | |||||
UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681842 | 2e-99 | LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022. | |||
GenBank | LN713259 | 2e-99 | LN713259.1 Cucumis melo genomic chromosome, chr_5. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022989259.1 | 2e-19 | transcription factor TCP10-like | ||||
Swissprot | A2WM14 | 4e-16 | PCF5_ORYSI; Transcription factor PCF5 | ||||
Swissprot | Q8LT07 | 4e-16 | PCF5_ORYSJ; Transcription factor PCF5 | ||||
TrEMBL | A0A2R6QXG8 | 8e-17 | A0A2R6QXG8_ACTCH; Transcription factor like | ||||
TrEMBL | C6TEY2 | 7e-17 | C6TEY2_SOYBN; Uncharacterized protein (Fragment) | ||||
STRING | VIT_12s0028g02520.t01 | 2e-16 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF24944 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31070.1 | 2e-18 | TCP domain protein 10 |