PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000287530

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

M-type_MADS

Protein Properties

Length: 132aa MW: 14518.5 Da PI: 10.6348

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000287530	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	49.2	6.6e-16	51	99	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ien+ +vtfsk + g++ KA+ LS L +aevaviifs++gk y + MDP0000287530 51 KKIENSGSLYVTFSKXKVGLFRKASTLSALYGAEVAVIIFSPHGKTYVF 99 68*******************************************9977 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.0E-18	43	102	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-14	45	65	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.33E-21	46	114	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	19.063	46	103	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.6E-17	52	99	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-14	65	80	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.5E-14	80	101	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MARAALISSS KSSSADYKYK PTIANSYMSD IRRSTLTLTK QKPKPRKIEI KKIENSGSLY 60 VTFSKXKVGL FRKASTLSAL YGAEVAVIIF SPHGKTYVFG HSSVDSVLSR LESTDTPLHG 120 CQQNVSMHAR VV

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269\|PubMed:18334668}.
Uniprot	TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:18334668}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009349899.1	8e-62	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	6e-18	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A498I2F7	1e-68	A0A498I2F7_MALDO; Uncharacterized protein
STRING	XP_009349899.1	3e-61	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF128	33	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	2e-17	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	MDP0000287530

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]