PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000193953

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

M-type_MADS

Protein Properties

Length: 103aa MW: 11715.5 Da PI: 10.3704

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000193953	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	81.6	5e-26	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifss+gkl+e + MDP0000193953 9 KRIENMVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSSHGKLFELA 58 79********************************************9965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.408	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.59E-26	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.2E-35	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.48E-37	2	85	No hit	No description
PRINTS	PR00404	2.1E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.0E-22	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MARGKVQMKR IENMVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSS HGKLFELATK 60 GSXALSTYFC IIIISMQGLI ERYMKMKSTX APQTEQTMET QTL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-16	1	59	1	59	MEF2C
5f28_B	2e-16	1	59	1	59	MEF2C
5f28_C	2e-16	1	59	1	59	MEF2C
5f28_D	2e-16	1	59	1	59	MEF2C
6byy_A	2e-16	1	59	1	59	MEF2 CHIMERA
6byy_B	2e-16	1	59	1	59	MEF2 CHIMERA
6byy_C	2e-16	1	59	1	59	MEF2 CHIMERA
6byy_D	2e-16	1	59	1	59	MEF2 CHIMERA
6bz1_A	2e-16	1	59	1	59	MEF2 CHIMERA
6bz1_B	2e-16	1	59	1	59	MEF2 CHIMERA
6bz1_C	2e-16	1	59	1	59	MEF2 CHIMERA
6bz1_D	2e-16	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269\|PubMed:11855641}.
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269\|PubMed:11855641, ECO:0000269\|PubMed:18203871, ECO:0000269\|PubMed:7549482}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP164021	7e-97	KP164021.1 Pyrus pyrifolia clone PpAGL12-2 AGL12-like MADS-box protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008347849.2	5e-55	agamous-like MADS-box protein AGL12 isoform X1
Swissprot	Q38841	2e-35	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A0D4ZY50	2e-48	A0A0D4ZY50_PYRPY; AGL12-like MADS-box protein
STRING	XP_008347849.1	2e-54	(Malus domestica)
STRING	XP_008378783.1	3e-55	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7566	31	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	9e-38	AGAMOUS-like 12

Link Out ? help Back to Top
Phytozome	MDP0000193953

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]