PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

NAC

Protein Properties

Length: 232aa MW: 26793.5 Da PI: 8.0784

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_85210g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	140.7	8.7e-44	24	151	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 pGfrF Pt+eelv +yL ++v+g++ l+++ +i+++d+y+++Pw+L +++a+e++w+fF++rd+k++ r+nr t sgyWkatg+d++v +k MA_85210g0010 24 IPGFRFYPTEEELVGFYLMRRVQGSHpLNFDIIIPTLDLYRYDPWELAgFAHDAGERQWFFFVPRDHKKS-CPRPNRLTGSGYWKATGSDRAVRNK 118 69********************996666566**********9667888999******986.58******************9 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 + +glkk+Lvfykg++p g+ktdW+m+eyr+ MA_85210g0010 119 LLQCIGLKKILVFYKGKDPYGQKTDWIMNEYRM 151 9999*************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.83E-46	16	172	IPR003441	NAC domain
PROSITE profile	PS51005	49.718	23	172	IPR003441	NAC domain
Pfam	PF02365	2.2E-24	25	151	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 232 aa Download sequence Send to blast
MKIQIAMLEE VYNDGVLQGE STVIPGFRFY PTEEELVGFY LMRRVQGSHP LNFDIIIPTL 60 DLYRYDPWEL AGFAHDAGER QWFFFVPRDH KKSCPRPNRL TGSGYWKATG SDRAVRNKLL 120 QCIGLKKILV FYKGKDPYGQ KTDWIMNEYR MPDFSSSAHK VKDIVLCRIH RKAVSQKWTD 180 NGAKTNPVEK EEPVVPGDEY EEKSHLITLN RSLIQSNPTP ETVEVSSSLQ HN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-42	22	177	16	170	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-42	22	177	16	170	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-42	22	177	16	170	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-42	22	177	16	170	NO APICAL MERISTEM PROTEIN
3swm_A	1e-42	25	177	22	173	NAC domain-containing protein 19
3swm_B	1e-42	25	177	22	173	NAC domain-containing protein 19
3swm_C	1e-42	25	177	22	173	NAC domain-containing protein 19
3swm_D	1e-42	25	177	22	173	NAC domain-containing protein 19
3swp_A	1e-42	25	177	22	173	NAC domain-containing protein 19
3swp_B	1e-42	25	177	22	173	NAC domain-containing protein 19
3swp_C	1e-42	25	177	22	173	NAC domain-containing protein 19
3swp_D	1e-42	25	177	22	173	NAC domain-containing protein 19
4dul_A	1e-42	22	177	16	170	NAC domain-containing protein 19
4dul_B	1e-42	22	177	16	170	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008791987.1	3e-56	NAC domain-containing protein 22-like
Swissprot	Q9ZVP8	8e-53	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A075M5N5	7e-98	A0A075M5N5_9SPER; NAC domain protein
STRING	XP_008791987.1	1e-55	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.1	2e-55	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]