PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10018283 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 95aa MW: 10487.5 Da PI: 10.9134 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 44.6 | 3.8e-14 | 32 | 87 | 19 | 74 |
trihelix 19 erlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtse 74 +++++++ + +W++v ++++++g+ rs++qC++kw+nl ++ykk++++ +r+ + Lus10018283 32 SSSGSKAGGELRWKWVEDYCWKKGCFRSQNQCNDKWDNLMRDYKKVRDHPPRRRHR 87 455556667889*************************************9988543 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF13837 | 2.1E-10 | 37 | 82 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MWEWRGGGGE RGGEGGGGGG GGGGGGNSTT GSSSGSKAGG ELRWKWVEDY CWKKGCFRSQ 60 NQCNDKWDNL MRDYKKVRDH PPRRRHRRRN GSWR* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10018283 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015882939.1 | 3e-26 | uncharacterized protein LOC107418735 isoform X4 | ||||
TrEMBL | A0A103SX29 | 3e-24 | A0A103SX29_CYNCS; Uncharacterized protein | ||||
TrEMBL | W9R7D1 | 2e-23 | W9R7D1_9ROSA; Uncharacterized protein | ||||
STRING | Lus10018283 | 3e-58 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6804 | 32 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31310.1 | 1e-21 | Trihelix family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10018283 |