PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj1g3v0579530.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

Dof

Protein Properties

Length: 87aa MW: 10238.8 Da PI: 10.725

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj1g3v0579530.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	120.8	4.8e-38	19	78	2	61
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrn+ vG+g+rk k+s Lj1g3v0579530.1 19 HHQILKCPRCESLNTKFCYYNNYNLSQPRHFCKGCRRYWTKGGLLRNITVGSGSRKPKRS 78 57899***************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-24	19	77	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.6E-32	21	77	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	27.587	23	77	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	25	61	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MQEIHDHSMT ERKVPRPHHH QILKCPRCES LNTKFCYYNN YNLSQPRHFC KGCRRYWTKG 60 GLLRNITVGS GSRKPKRSIN KNTVPSA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj1g3v0579530.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ857273	2e-44	DQ857273.1 Glycine max Dof22 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018463728.1	7e-34	PREDICTED: dof zinc finger protein DOF5.4-like
Swissprot	Q8LDR0	8e-33	DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBL	A0A4D9AF69	2e-34	A0A4D9AF69_SALSN; Uncharacterized protein
STRING	evm.model.supercontig_3.229	5e-33	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5998	30	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60850.1	4e-35	OBF binding protein 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu P,Chen H,Ying L,Cai W AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana. Sci Rep, 2016. 6: p. 27705 [PMID:27297966] Ramirez-Parra E, et al. The transcription factor OBP4 controls root growth and promotes callus formation. New Phytol., 2017. 213(4): p. 1787-1801 [PMID:27859363] Rymen B, et al. ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator. Plant Physiol., 2017. 173(3): p. 1750-1762 [PMID:28167701]