PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR05G15380.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 190aa MW: 19896.3 Da PI: 7.6206 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.9 | 1.1e-56 | 32 | 125 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyre + LPERR05G15380.1 32 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREGD 125 69*****************************************************************************************965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-53 | 31 | 131 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.5E-39 | 35 | 126 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.6E-28 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-22 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-22 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 1.4E-22 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MADGPASPGG GGGSHESGSP RGGGGGGGGG GVREQDRFLP IANISRIMKK AIPANGKIAK 60 DAKETVQECV SEFISFITSE ASDKCQREKR KTINGDDLLW AMATLGFEDY IEPLKVYLQK 120 YREGDSKLTA KTGDGSVKKD VLGSHGGGSN SSAGMGQQGV YNQGMGYMQP QSLASILHLM 180 VSSEGTYHHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 5e-50 | 31 | 123 | 1 | 93 | NF-YB |
4awl_B | 5e-50 | 31 | 123 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-50 | 31 | 123 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR05G15380.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK100811 | 1e-178 | AK100811.1 Oryza sativa Japonica Group cDNA clone:J023121O11, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021302548.1 | 2e-92 | nuclear transcription factor Y subunit B | ||||
Swissprot | P25209 | 2e-90 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A0A0D9WHF6 | 1e-136 | A0A0D9WHF6_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR05G15380.1 | 1e-137 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 8e-67 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|