PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

LPERR02G27610.1

Organism

Leersia perrieri

Taxonomic ID

77586

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia

Family

bZIP

Protein Properties

Length: 288aa MW: 31294.8 Da PI: 10.4189

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
LPERR02G27610.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.6	3.7e-15	208	256	5	53
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ ee+ LPERR02G27610.1 208 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNEDLQKKQEEML 256 79***************************************97766543 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.8E-13	204	269	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.254	206	258	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.53E-10	208	258	No hit	No description
CDD	cd14707	4.25E-24	208	260	No hit	No description
Pfam	PF00170	1.2E-13	208	258	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.4E-14	208	259	No hit	No description
PROSITE pattern	PS00036	0	211	226	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0010255	Biological Process	glucose mediated signaling pathway
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0000976	Molecular Function	transcription regulatory region sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 288 aa Download sequence Send to blast
MDFPGGSGRQ QQQPQQQQLP PMTPLPLARQ GSVYSLTFDE FQTTLGGVGK DFGSMNMDEL 60 LRSIWTAEES HAVGEPAAVQ RQGSLTLPRT LSQKTDMSVP PAPAPAAVPP PPPPPPPPQQ 120 QPPSVLFGES NVFAPIVPPL SLGNGLVTGG RGGGAAPLLS PVRPVSSNGF GKMEGGDLSS 180 LSPSPVPYVF NGGLRGRKAP GIEKVVERRQ RRMIKNRESA ARSRQRKQAY MMELEAEVAK 240 LKELNEDLQK KQEEMLEQQK NEALERITRQ VGPTTKRICL RRTLTGPW

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates abscisic acid (ABA) signaling (PubMed:18931143, PubMed:19947981, PubMed:27424498, PubMed:27325665). Can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. Confers ABA-dependent drought and salinity tolerance (PubMed:18931143, PubMed:27325665). Binds specifically to the ABA-responsive elements (ABRE) in the promoter of target genes to mediate stress-responsive ABA signaling (PubMed:27325665, PubMed:27424498). {ECO:0000269\|PubMed:18931143, ECO:0000269\|PubMed:19947981, ECO:0000269\|PubMed:27325665, ECO:0000269\|PubMed:27424498}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00186	DAP	Transfer from AT1G45249	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	LPERR02G27610.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) (PubMed:18315698, PubMed:18931143). Induced by drought, salt and osmotic stresses (PubMed:18931143). {ECO:0000269\|PubMed:18315698, ECO:0000269\|PubMed:18931143}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP779638	1e-155	KP779638.1 Oryza nivara OsbZIP23 (bZIP23) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015688745.1	1e-136	PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
Swissprot	Q6Z312	4e-92	BZP23_ORYSJ; bZIP transcription factor 23
TrEMBL	A0A0D9VLF8	0.0	A0A0D9VLF8_9ORYZ; Uncharacterized protein
STRING	LPERR02G27610.1	0.0	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP706	38	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G19290.2	2e-26	ABRE binding factor 4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Xiang Y,Tang N,Du H,Ye H,Xiong L Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice. Plant Physiol., 2008. 148(4): p. 1938-52 [PMID:18931143] Shen J,Xie K,Xiong L Global expression profiling of rice microRNAs by one-tube stem-loop reverse transcription quantitative PCR revealed important roles of microRNAs in abiotic stress responses. Mol. Genet. Genomics, 2010. 284(6): p. 477-88 [PMID:20941508] Luo C,Guo C,Wang W,Wang L,Chen L Overexpression of a new stress-repressive gene OsDSR2 encoding a protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice. Plant Cell Rep., 2014. 33(2): p. 323-36 [PMID:24247850] Sakuraba Y, et al. Rice ONAC106 Inhibits Leaf Senescence and Increases Salt Tolerance and Tiller Angle. Plant Cell Physiol., 2015. 56(12): p. 2325-39 [PMID:26443376] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774] Dey A,Samanta MK,Gayen S,Sen SK,Maiti MK Enhanced Gene Expression Rather than Natural Polymorphism in Coding Sequence of the OsbZIP23 Determines Drought Tolerance and Yield Improvement in Rice Genotypes. PLoS ONE, 2016. 11(3): p. e0150763 [PMID:26959651] Zong W, et al. Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes. Plant Physiol., 2016. 171(4): p. 2810-25 [PMID:27325665] Dey A,Samanta MK,Gayen S,Maiti MK The sucrose non-fermenting 1-related kinase 2 gene SAPK9 improves drought tolerance and grain yield in rice by modulating cellular osmotic potential, stomatal closure and stress-responsive gene expression. BMC Plant Biol., 2016. 16(1): p. 158 [PMID:27411911] Gui J, et al. OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice. Dev. Cell, 2016. 38(2): p. 201-13 [PMID:27424498]