PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KZV26153.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 209aa MW: 22904.5 Da PI: 6.1255 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 85.7 | 5.2e-27 | 35 | 83 | 1 | 49 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49 vreqdrflPian+srimkk+lPan+k++kdaketvqecvsefisfvtse KZV26153.1 35 VREQDRFLPIANISRIMKKALPANGKVAKDAKETVQECVSEFISFVTSE 83 69**********************************************9 PP | |||||||
2 | NF-YB | 76.3 | 4.6e-24 | 113 | 159 | 49 | 95 |
NF-YB 49 easdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 asdkcqrekrktingddllwa+atlGfedy++plk+yl++yre ++ KZV26153.1 113 RASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKMYLARYREGDT 159 69*****************************************9665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.6E-47 | 30 | 170 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.62E-16 | 38 | 83 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.2E-16 | 41 | 83 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.5E-17 | 69 | 87 | No hit | No description |
Pfam | PF00808 | 1.7E-4 | 112 | 135 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.83E-16 | 113 | 196 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 5.5E-17 | 118 | 136 | No hit | No description |
PRINTS | PR00615 | 5.5E-17 | 137 | 155 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MADGRPVGSS VQIPPGSPVG GSHDSGGDQS PRSGVREQDR FLPIANISRI MKKALPANGK 60 VAKDAKETVQ ECVSEFISFV TSEYGSFSFV NHVYVVSFAV ELEFQLRDYD FERASDKCQR 120 EKRKTINGDD LLWAMATLGF EDYIDPLKMY LARYREGDTK GSAKSADVSA RKDGLQSTSS 180 SQLVNQGSYS QGMNYGHSQV HFTPAGVDL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 3e-40 | 36 | 156 | 3 | 93 | NF-YB |
4awl_B | 3e-40 | 36 | 156 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-40 | 36 | 156 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 3e-40 | 35 | 156 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-40 | 35 | 156 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KZV26153.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011094723.1 | 4e-90 | nuclear transcription factor Y subunit B-8 | ||||
Swissprot | Q8VYK4 | 7e-71 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A2Z7AXF9 | 1e-154 | A0A2Z7AXF9_9LAMI; Nuclear transcription factor Y subunit B-10-like | ||||
STRING | XP_009620316.1 | 2e-88 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 3e-73 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|