PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc002962.1_g00008.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 87aa MW: 9664.52 Da PI: 10.4818 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 124.3 | 3.9e-39 | 20 | 87 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 ++ v akGlnPG+ivllv+ggl+l flvgny+ly++aqk+l P+kkkPvskkk+kre+l+qGv++PGe Itr_sc002962.1_g00008.1 20 KNVVTAKGLNPGMIVLLVIGGLVLAFLVGNYLLYMHAQKTLGPKKKKPVSKKKMKRERLRQGVSAPGE 87 677899*************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 3.1E-37 | 24 | 87 | IPR006779 | DNA binding protein S1FA |
ProDom | PD019013 | 0.005 | 26 | 87 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MDFEEEFADQ HVPPSFDPMK NVVTAKGLNP GMIVLLVIGG LVLAFLVGNY LLYMHAQKTL 60 GPKKKKPVSK KKMKRERLRQ GVSAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019152005.1 | 4e-44 | PREDICTED: DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 2e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | B9SGP8 | 2e-24 | B9SGP8_RICCO; DNA-binding protein S1FA, putative | ||||
STRING | XP_002525167.1 | 4e-25 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37120.1 | 9e-06 | S1FA-like DNA-binding protein |