PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000246.1_g00026.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 128aa MW: 13953.5 Da PI: 4.9789 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 24.3 | 6.8e-08 | 18 | 93 | 9 | 83 |
NF-YC 9 qiekatdfknhelPlarikkilkad.edvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaav 83 q e+++ ++lP+a + +i+k+ +d i+aea l+ fi +t + + + kr+tl d+ +++ Itr_sc000246.1_g00026.1 18 QSENHNPEYVRSLPIANVVRIMKKAlPDDANITAEAKLLVEECATEFISFITSEASERGQIEKRKTLTGDDVLNSL 93 556666666789**********85449**************99999**********************99998765 PP | |||||||
2 | NF-YB | 127.4 | 5.2e-40 | 28 | 116 | 6 | 94 |
NF-YB 6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 r lPianv+rimkk+lP +a i+ +ak +v+ec++efisf+tseas++ q ekrkt++gdd+l +l tlGf +yvepl++yl+ky+ Itr_sc000246.1_g00026.1 28 RSLPIANVVRIMKKALPDDANITAEAKLLVEECATEFISFITSEASERGQIEKRKTLTGDDVLNSLNTLGFGNYVEPLRTYLMKYK 113 89************************************************************************************ PP NF-YB 92 ele 94 e + Itr_sc000246.1_g00026.1 114 END 116 965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.6E-41 | 18 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.84E-32 | 28 | 125 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.0E-21 | 29 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.4E-14 | 57 | 75 | No hit | No description |
PRINTS | PR00615 | 2.4E-14 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 2.4E-14 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MEGAPGGGGG GGSHQSSQSE NHNPEYVRSL PIANVVRIMK KALPDDANIT AEAKLLVEEC 60 ATEFISFITS EASERGQIEK RKTLTGDDVL NSLNTLGFGN YVEPLRTYLM KYKENDFKEE 120 NKGSNSRG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-34 | 28 | 114 | 6 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-34 | 28 | 114 | 6 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019198523.1 | 8e-55 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q8VYK4 | 3e-36 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A4D6MXJ7 | 2e-37 | A0A4D6MXJ7_VIGUN; Nuclear transcription factor Y | ||||
STRING | Bo3g031490.1 | 1e-37 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 2e-37 | nuclear factor Y, subunit B1 |
Publications ? help Back to Top | |||
---|---|---|---|
|