PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Itr_sc000120.1_g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 134aa MW: 15225.8 Da PI: 9.175 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.6 | 3.1e-42 | 37 | 113 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cqve+C+adls+ak+yhrrhkvCe+h+ka+vv+++gl+qrfCqqCsrfhe+ efD++krsCrrrLa+hnerrrk++ Itr_sc000120.1_g00007.1 37 CCQVEKCSADLSDAKQYHRRHKVCEHHAKAQVVIIAGLRQRFCQQCSRFHEVGEFDDAKRSCRRRLAGHNERRRKNS 113 6**************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 5.3E-54 | 1 | 127 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.4E-34 | 31 | 99 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.958 | 35 | 112 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 7.95E-38 | 36 | 114 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 9.1E-33 | 38 | 111 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MEEDLLRDED NKKRRGGSHH GRKGGENSGY GGGSMRCCQV EKCSADLSDA KQYHRRHKVC 60 EHHAKAQVVI IAGLRQRFCQ QCSRFHEVGE FDDAKRSCRR RLAGHNERRR KNSAADSHAA 120 EEGTSQKVDE HGRI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-37 | 31 | 111 | 4 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019159042.1 | 2e-65 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 8e-42 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A2K9ZXU3 | 2e-50 | A0A2K9ZXU3_PETHY; Squamosa promoter-binding-like protein | ||||
STRING | XP_009626190.1 | 5e-50 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 2e-41 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|