PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

3D Structure |

Gene Ontology |

Regulation |

Orthologous Group |

Basic Information? help Back to Top

TF ID

HL.SW.v1.0.G019567.1

Organism

Humulus lupulus

Taxonomic ID

3486

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus

Family

NF-YC

Protein Properties

Length: 68aa MW: 7614.07 Da PI: 10.2169

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
HL.SW.v1.0.G019567.1	genome	HOPBASE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	48	2.8e-15	6	62	18	74
NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtl 74 ++++P arikki++adedv +i+ +Pvl+ska elf+ +l r++ + + +t+ HL.SW.v1.0.G019567.1 6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTM 62 5789****************************************9998888777776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.4E-25	3	67	IPR009072	Histone-fold
SuperFamily	SSF47113	3.67E-15	4	66	IPR009072	Histone-fold
Pfam	PF00808	6.1E-19	8	67	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005829	Cellular Component	cytosol
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK 60 TMNSLHL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1jfi_A	6e-23	2	67	5	70	Transcription Regulator NC2 alpha chain
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024952614.1	5e-41	uncharacterized protein LOC102616753 isoform X1
Refseq	XP_024952618.1	2e-41	dr1-associated corepressor-like isoform X9
Swissprot	Q14919	3e-21	NC2A_HUMAN; Dr1-associated corepressor
TrEMBL	A0A0B2PUJ1	3e-41	A0A0B2PUJ1_GLYSO; Dr1-associated corepressor
STRING	XP_008346600.1	1e-39	(Malus domestica)
STRING	XP_008364739.1	6e-40	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1728	34	91

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G12480.1	2e-41	nuclear factor Y, subunit C11