![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.013G184200.3 | ||||||||
Common Name | B456_013G184200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 202aa MW: 21775.5 Da PI: 9.8941 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 79.6 | 3e-25 | 89 | 133 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+ Gorai.013G184200.3 89 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 133 79****************************************986 PP | |||||||
2 | QLQ | 65.3 | 1.5e-22 | 27 | 63 | 1 | 37 |
QLQ 1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 s+FT +Q+q+L++Q+l++Ky++a++PvPp+L+++iqk Gorai.013G184200.3 27 SPFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQK 63 89*********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 1.1E-12 | 27 | 63 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 1.8E-16 | 28 | 62 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 24.498 | 28 | 63 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 25.762 | 89 | 133 | IPR014977 | WRC domain |
Pfam | PF08879 | 1.8E-21 | 90 | 132 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MNSGGGGGGG GAESAGVGMV AMRSSSSPFT VSQWQELEHQ ALIFKYMMAG LPVPPDLVLP 60 IQKSFESISQ RFFHHPTMGY CSFYGKKVDP EPGRCRRTDG KKWRCSKDAY PDSKYCERHM 120 HRGRNRSRKP VESQTMAQSL STVTSLTVSG STTGGGGTGT ASFQSLPLHA FGGTQVTALA 180 TGQSNYHVES IPYGIPRKDY R* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stems (PubMed:27107174). Expressed in panicles (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747, ECO:0000269|PubMed:27250749}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269|PubMed:24532604, ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:26936408, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747, ECO:0000269|PubMed:27250749, ECO:0000305|PubMed:26187814, ECO:0000305|PubMed:27107174, ECO:0000305|PubMed:27250747, ECO:0000305|PubMed:27250749}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:26936408, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ382488 | 2e-46 | FQ382488.1 Vitis vinifera clone SS0ABG55YD19. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012463459.1 | 1e-148 | PREDICTED: growth-regulating factor 4-like | ||||
Refseq | XP_016704987.1 | 1e-148 | PREDICTED: growth-regulating factor 4-like | ||||
Swissprot | Q6ZIK5 | 2e-60 | GRF4_ORYSJ; Growth-regulating factor 4 | ||||
TrEMBL | A0A0D2U066 | 1e-148 | A0A0D2U066_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.013G184200.1 | 1e-147 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13960.1 | 4e-47 | growth-regulating factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.013G184200.3 |