PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.011G120200.1

Common Name

B456_011G120200

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB_related

Protein Properties

Length: 96aa MW: 11092.1 Da PI: 10.7333

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.011G120200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57	4.3e-18	27	73	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT +Ed +l+++vkq+G + W+ Ia+ + gR +kqc++rw+++l Gorai.011G120200.1 27 KGQWTDDEDRKLIRLVKQYGVRKWAQIAESLV-GRAGKQCRERWHNHL 73 799***************************.***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.9E-24	19	80	IPR009057	Homeodomain-like
PROSITE profile	PS51294	28.006	22	77	IPR017930	Myb domain
SuperFamily	SSF46689	3.11E-19	24	79	IPR009057	Homeodomain-like
SMART	SM00717	2.0E-16	26	75	IPR001005	SANT/Myb domain
CDD	cd00167	2.73E-14	30	73	No hit	No description
Pfam	PF13921	3.2E-17	30	83	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
MKASMKGDFP KWVVKRNTKV ASAALIKGQW TDDEDRKLIR LVKQYGVRKW AQIAESLVGR 60 AGKQCRERWH NHLRPNIKEM QCLASTLCMP LWIEL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-20	25	78	5	58	B-MYB
1h88_C	1e-19	19	78	50	109	MYB PROTO-ONCOGENE PROTEIN
1h89_C	1e-19	19	78	50	109	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During female gametogenesis, expressed in the female gametophyte at stage FG4 (four-nucleate stage) in all four nuclei. Expressed in the central cell in unfused polar nuclei at stage FG5 and secondary nucleus at stage FG6. Not expressed in mature female gametophytes (stage FG7). {ECO:0000269\|PubMed:24068955}.
Uniprot	TISSUE SPECIFICITY: Expressed in ovary septum and stamen filament. {ECO:0000269\|PubMed:24068955}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269\|PubMed:24068955}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012454624.1	2e-48	PREDICTED: transcription factor MYB44-like isoform X2
Swissprot	Q9FIM4	2e-26	MY119_ARATH; Transcription factor MYB119
TrEMBL	A0A0D2T6S5	5e-64	A0A0D2T6S5_GOSRA; Uncharacterized protein
STRING	Gorai.011G120200.1	8e-65	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM27405	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58850.1	1e-28	myb domain protein 119

Link Out ? help Back to Top
Phytozome	Gorai.011G120200.1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886]