![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.002G054200.5 | ||||||||
Common Name | B456_002G054200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 115aa MW: 12593.3 Da PI: 9.2249 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 75.4 | 1.9e-23 | 4 | 64 | 2 | 62 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh 62 +++s++eq+Cy+ Cn Cn ilav+vP +slf++vtvrCG C++l svnla + q +a ++ Gorai.002G054200.5 4 SHNSAPEQLCYIPCNLCNIILAVNVPCNSLFETVTVRCGQCSNLCSVNLAASFQSRAGKDV 64 68899**********************************************9999988874 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.8E-24 | 8 | 98 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MSSSHNSAPE QLCYIPCNLC NIILAVNVPC NSLFETVTVR CGQCSNLCSV NLAASFQSRA 60 GKDVQVPNYT SSEYRIDLGS SSRCKNKLPK RATTINTTTQ ERVVNRQRRF RGSS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012455973.1 | 3e-72 | PREDICTED: axial regulator YABBY 5-like isoform X1 | ||||
Refseq | XP_012455982.1 | 3e-72 | PREDICTED: axial regulator YABBY 5-like isoform X1 | ||||
Refseq | XP_012455990.1 | 3e-72 | PREDICTED: axial regulator YABBY 5-like isoform X1 | ||||
Refseq | XP_016732275.1 | 3e-72 | PREDICTED: axial regulator YABBY 5-like | ||||
Refseq | XP_016732276.1 | 3e-72 | PREDICTED: axial regulator YABBY 5-like | ||||
Swissprot | Q8GW46 | 3e-34 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A0D2QXI8 | 4e-77 | A0A0D2QXI8_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.002G054200.1 | 1e-71 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 1e-36 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.002G054200.5 |
Publications ? help Back to Top | |||
---|---|---|---|
|