PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB

Protein Properties

Length: 187aa MW: 21273 Da PI: 9.9459

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.20G013000.2.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.2	7.1e-17	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++lvd++k++G +W+t ++ g++R++k+c++rw +yl Glyma.20G013000.2.p 13 KGAWSKQEDQKLVDYIKKHGEVCWRTLPQAAGLHRCGKSCRLRWINYL 60 79****************99**********************97 PP
2	Myb_DNA-binding	52	1.7e-16	66	110	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++ Glyma.20G013000.2.p 66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110 8999****************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.68	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	3.67E-28	11	107	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-13	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	2.9E-14	13	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.8E-22	14	67	IPR009057	Homeodomain-like
CDD	cd00167	3.07E-10	15	60	No hit	No description
PROSITE profile	PS51294	26.297	61	115	IPR017930	Myb domain
SMART	SM00717	4.1E-15	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-15	66	110	IPR001005	SANT/Myb domain
CDD	cd00167	1.14E-10	68	111	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.3E-26	68	116	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 187 aa Download sequence Send to blast
MRKPSCDIKE LNKGAWSKQE DQKLVDYIKK HGEVCWRTLP QAAGLHRCGK SCRLRWINYL 60 RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRKKLISNGI 120 DPNNHRLNHT IPSVYQNPPM SDDSSKHFGM KDNNSKNETS KSPRVYNHGE VSDAASVINQ 180 STSTLA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-30	8	115	2	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. {ECO:0000269\|PubMed:9839469}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.20G013000.2.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT699108	1e-111	KT699108.1 Trifolium repens MYB133 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003556646.1	1e-130	transcription factor MYB3
Refseq	XP_028221328.1	1e-130	transcription factor MYB3-like
Swissprot	Q9S9K9	2e-73	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A0R0E5A3	1e-136	A0A0R0E5A3_SOYBN; Uncharacterized protein
STRING	GLYMA20G01610.2	1e-130	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	9e-76	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Glyma.20G013000.2.p

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]