PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.14G139500.1.p | ||||||||
Common Name | GLYMA_14G139500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 203aa MW: 23488 Da PI: 6.2562 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 81.2 | 1.1e-25 | 127 | 180 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprl+W eLH++F+ av+ L G++kA Pk+il+lm+v+gLt+e+v+SHLQkY+l Glyma.14G139500.1.p 127 KPRLVWDVELHRKFLVAVDDL-GIDKAFPKRILDLMNVEGLTRENVASHLQKYKL 180 79*******************.*******************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50110 | 13.548 | 1 | 71 | IPR001789 | Signal transduction response regulator, receiver domain |
Gene3D | G3DSA:3.40.50.2300 | 1.9E-12 | 7 | 120 | No hit | No description |
SuperFamily | SSF52172 | 1.57E-11 | 7 | 72 | IPR011006 | CheY-like superfamily |
Pfam | PF00072 | 2.7E-5 | 7 | 65 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 1.45E-9 | 7 | 71 | No hit | No description |
PROSITE profile | PS51294 | 10.797 | 124 | 183 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-26 | 125 | 184 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.15E-17 | 125 | 184 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 5.8E-23 | 127 | 180 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MLRKNINKFD LLISDVNIPD MDGFKLLELV GLQMDLPFIT KIKHFVIQGA CEYLTKPIRI 60 EELQNIWKHF ANEEKASYMA GECSQAMAPK NNTDQNIKLG QKRKEQSEDE EEEEYHKENE 120 EHLNQNKPRL VWDVELHRKF LVAVDDLGID KAFPKRILDL MNVEGLTREN VASHLQKYKL 180 DLRKPTRQPS MVAKLGSSDP CL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 1e-22 | 125 | 184 | 3 | 62 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.14G139500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028188502.1 | 2e-98 | two-component response regulator ARR12-like | ||||
Swissprot | B8AEH1 | 1e-60 | ORR23_ORYSI; Two-component response regulator ORR23 | ||||
Swissprot | Q6K8X6 | 1e-60 | ORR23_ORYSJ; Two-component response regulator ORR23 | ||||
TrEMBL | A0A445H5G0 | 1e-148 | A0A445H5G0_GLYSO; Two-component response regulator ORR23 | ||||
TrEMBL | K7M6N9 | 1e-148 | K7M6N9_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA14G19985.1 | 1e-149 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF956 | 34 | 112 | Representative plant | OGRP1157 | 17 | 53 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G25180.1 | 1e-54 | response regulator 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.14G139500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|