PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G313800.1.p
Common NameGLYMA_13G313800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 139aa    MW: 15706.2 Da    PI: 10.3528
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G313800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF688.8e-222166449
                         -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
               SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                          n+ n qvtfskRr g++KKA+ELS+LC+a va+++fs+  k++ +
  Glyma.13G313800.1.p 21 CNEANLQVTFSKRRSGLFKKASELSTLCGASVALVVFSPGKKVFSF 66
                         58999**********************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.6281070IPR002100Transcription factor, MADS-box
SMARTSM004324.2E-301069IPR002100Transcription factor, MADS-box
CDDcd002651.81E-341180No hitNo description
SuperFamilySSF554556.67E-281188IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-201232IPR002100Transcription factor, MADS-box
PfamPF003191.5E-242066IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-203247IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-204768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MSSSEAKKSR GRQRIEIKKM CNEANLQVTF SKRRSGLFKK ASELSTLCGA SVALVVFSPG  60
KKVFSFGHPS VDGVIERYLT QGPTPLMDVQ RMAELEAERK RAQELSGKER ETEAHLWWAR  120
PVEGMISIDN LYKLKKAFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-161178168Myocyte-specific enhancer factor 2A
3kov_B1e-161178168Myocyte-specific enhancer factor 2A
3kov_I1e-161178168Myocyte-specific enhancer factor 2A
3kov_J1e-161178168Myocyte-specific enhancer factor 2A
3mu6_A9e-171178168Myocyte-specific enhancer factor 2A
3mu6_B9e-171178168Myocyte-specific enhancer factor 2A
3mu6_C9e-171178168Myocyte-specific enhancer factor 2A
3mu6_D9e-171178168Myocyte-specific enhancer factor 2A
3p57_A1e-161178168Myocyte-specific enhancer factor 2A
3p57_B1e-161178168Myocyte-specific enhancer factor 2A
3p57_C1e-161178168Myocyte-specific enhancer factor 2A
3p57_D1e-161178168Myocyte-specific enhancer factor 2A
3p57_I1e-161178168Myocyte-specific enhancer factor 2A
3p57_J1e-161178168Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}.
UniprotTISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G313800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028187674.17e-92agamous-like MADS-box protein AGL62
SwissprotQ9FKK22e-41AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A0R0H9T95e-98A0A0R0H9T9_SOYBN; Uncharacterized protein (Fragment)
STRINGGLYMA13G39016.12e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-44AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]