PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

Dof

Protein Properties

Length: 148aa MW: 16625.9 Da PI: 9.8955

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.13G230200.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	118.6	2.4e-37	38	96	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnv vG+grrk k+ Glyma.13G230200.1.p 38 AEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVAVGAGRRKVKS 96 57899***************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-27	37	95	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.5E-31	40	96	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	27.419	42	96	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	44	80	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MAEESQGIKL FGAMITLNRG EVNKGEKGSE YERVEKRAEK IIPCPRCKSM ETKFCYFNNY 60 NVNQPRHFCK SCQRYWTAGG ALRNVAVGAG RRKVKSPCHG AGVYESTSED ENKFEMGQGH 120 VAMPNTGFRQ IFQAKRQRIT SAQHQGQ*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269\|PubMed:19619493}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.13G230200.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF221752	0.0	EF221752.1 Glycine max Dof10 transcription factor (Dof10) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001239867.1	1e-107	dof zinc finger protein DOF1.5-like
Refseq	XP_028188483.1	1e-107	dof zinc finger protein DOF1.5-like isoform X2
Swissprot	P68350	2e-42	DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBL	A0A445I8Q4	1e-106	A0A445I8Q4_GLYSO; Dof zinc finger protein DOF1.5
TrEMBL	B0EW02	1e-106	B0EW02_SOYBN; Dof10 transcription factor
STRING	GLYMA13G30331.1	1e-107	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6483	32	51
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29160.1	1e-44	Dof family protein

Link Out ? help Back to Top
Phytozome	Glyma.13G230200.1.p
Entrez Gene	100776748

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]