 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Glyma.13G003600.1.p |
Common Name | GLYMA_13G003600 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
Family |
NF-YB |
Protein Properties |
Length: 114aa MW: 12798.7 Da PI: 7.7382 |
Description |
NF-YB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Glyma.13G003600.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NF-YB | 105.9 | 2.7e-33 | 28 | 91 | 2 | 65 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingd 65
reqd flPian+s imkk+lP+n ki+kdaket+qecvsefisfvt+e sdkcq ekrktin d
Glyma.13G003600.1.p 28 REQDCFLPIANISCIMKKMLPSNRKIAKDAKETLQECVSEFISFVTCEVSDKCQGEKRKTINDD 91
89***********************************************************965 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1n1j_A | 1e-24 | 27 | 91 | 2 | 66 | NF-YB |
4awl_B | 1e-24 | 27 | 91 | 3 | 67 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-24 | 27 | 91 | 3 | 67 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 1e-24 | 27 | 91 | 1 | 65 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-24 | 27 | 91 | 1 | 65 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |