PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G013300.1.p
Common NamebZIP59, GLYMA_10G013300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family bZIP
Protein Properties Length: 153aa    MW: 16834.1 Da    PI: 5.0661
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G013300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.11.6e-122576556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                         ++ +r+++NRe+ArrsR +K++ +e L + +  L++eN +L++ ++  ++ +
  Glyma.10G013300.1.p 25 RKRKRMESNRESARRSRMKKQKLLEDLSDVASRLQGENVRLAQSIKAKEEAY 76
                         6789**************************************9999877766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-112185IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.2E-92374No hitNo description
PROSITE profilePS502179.8872370IPR004827Basic-leucine zipper domain
PfamPF001704.1E-92576IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-92575No hitNo description
CDDcd147021.49E-162676No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MASIPRPASS GSSEGGGDPA AMDERKRKRM ESNRESARRS RMKKQKLLED LSDVASRLQG  60
ENVRLAQSIK AKEEAYVEIE AANDILRAQT MELADRLRFL NSILEIADEV GGGGESFEIP  120
QIPDPLFMPW QIPHPMMASP DMLLHGNQGL FA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12445RKRKRMESNRESARRSRMKKQK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.44040.0cotyledon| flower| hypocotyl| leaf| meristem| pod| root| seed coat
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In developing seeds, accumulates in embryo cotyledons during late maturation, from the torpedo to the green cotyledon stages. Also present in endosperm. {ECO:0000269|PubMed:19531597}.
UniprotTISSUE SPECIFICITY: Expressed in developing seeds. {ECO:0000269|PubMed:19531597}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.10G013300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973640.0BT097364.1 Soybean clone JCVI-FLGm-21N16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237011.11e-107bZIP transcription factor bZIP59
RefseqXP_028185656.11e-107bZIP transcription factor 53-like
SwissprotQ9LZP86e-37BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A445IGH41e-105A0A445IGH4_GLYSO; BZIP transcription factor 53
TrEMBLQ0GPH71e-105Q0GPH7_SOYBN; BZIP transcription factor bZIP59
STRINGGLYMA10G01640.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42023460
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-39basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Liao Y, et al.
    Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis.
    Planta, 2008. 228(2): p. 225-40
    [PMID:18365246]
  2. Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X
    An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment.
    Front Plant Sci, 2017. 8: p. 277
    [PMID:28293251]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  5. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]