![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.09G046200.1.p | ||||||||
Common Name | GLYMA_09G046200, LOC102663543 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 118aa MW: 13216.9 Da PI: 5.2887 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 154.2 | 2.3e-48 | 17 | 100 | 2 | 85 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 +eqdr+lPianv+r+mk++lP+nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ngdd++walatlGf+dy+ep++ Glyma.09G046200.1.p 17 KEQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALATLGFDDYAEPMRR 100 89*******************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.1E-46 | 11 | 103 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.81E-35 | 19 | 110 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-27 | 22 | 86 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.1E-15 | 50 | 68 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.1E-15 | 69 | 87 | No hit | No description |
PRINTS | PR00615 | 5.1E-15 | 88 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MEDSIGGSSS NDNNIIKEQD RLLPIANVGR LMKQILPQNA KISKEAKETM QECVSEFISF 60 VTSEASEKCR KERRKTVNGD DICWALATLG FDDYAEPMRR KSRTKIQEAS TNQNDLC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-41 | 16 | 99 | 1 | 84 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-41 | 16 | 99 | 1 | 84 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.09G046200.1.p |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006586933.1 | 2e-82 | nuclear transcription factor Y subunit B-5 isoform X2 | ||||
Refseq | XP_028180554.1 | 2e-82 | nuclear transcription factor Y subunit B-5-like isoform X2 | ||||
Swissprot | O82248 | 2e-49 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A445IWU6 | 4e-81 | A0A445IWU6_GLYSO; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | K7LBT7 | 4e-81 | K7LBT7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA09G05150.2 | 6e-82 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-51 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.09G046200.1.p |
Entrez Gene | 102663543 |
Publications ? help Back to Top | |||
---|---|---|---|
|