![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.07G249000.1.p | ||||||||
Common Name | GLYMA_07G249000, LOC100786046 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 122aa MW: 13738.5 Da PI: 6.6304 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171.5 | 9.5e-54 | 18 | 113 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 reqdr+lPianv+rimk++lP nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal++lGf+dy+epl+ yl++yr Glyma.07G249000.1.p 18 REQDRLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGSLGFDDYAEPLRRYLQRYR 107 89**************************************************************************************** PP NF-YB 92 elegek 97 ele ++ Glyma.07G249000.1.p 108 ELEVDR 113 ***987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-51 | 11 | 115 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-38 | 20 | 117 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-27 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-19 | 51 | 69 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-19 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 1.8E-19 | 89 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MVDNVGGSSS NAENSGIREQ DRLLPIANVG RIMKQILPPN AKISKESKET MQECVSEFIS 60 FVTSEASEKC RKERRKTVNG DDICWALGSL GFDDYAEPLR RYLQRYRELE VDRGNSPPKR 120 E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-45 | 17 | 108 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-45 | 17 | 108 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.07G249000.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003529577.1 | 3e-85 | nuclear transcription factor Y subunit B-5 | ||||
Refseq | XP_028241700.1 | 3e-85 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 2e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A445K1B5 | 7e-84 | A0A445K1B5_GLYSO; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | K7L3Q0 | 7e-84 | K7L3Q0_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA07G37840.2 | 1e-84 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-49 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.07G249000.1.p |
Entrez Gene | 100786046 |
Publications ? help Back to Top | |||
---|---|---|---|
|