PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

YABBY

Protein Properties

Length: 192aa MW: 21571.3 Da PI: 5.3357

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.06G096500.2.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	156.7	2e-48	1	137	23	166
YABBY 23 avsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedee 108 +vsvP +sl++vvtvrCGhCt+llsvn+ kas +lla+ shl+ + + + +k+ +++ s+++ +++++++ Glyma.06G096500.2.p 1 MVSVPCSSLSMVVTVRCGHCTNLLSVNMLKASfipfHLLASLSHLEPKESSPEEDANKTLNSHSASMMTYSDCEEED----------IIP 80 59************************9999888899999999765544444444444444333333333333332..........222 PP YABBY 109 vprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPki 166 +++ + v++PPekrqr Psayn+fikeei+r+ka+nP+++h+eafs+aaknWa fP+ Glyma.06G096500.2.p 81 MSH-HVVNKPPEKRQRTPSAYNCFIKEEIKRLKAENPEMTHKEAFSTAAKNWANFPQT 137 332.3489**********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.0E-51	1	138	IPR006780	YABBY protein
SuperFamily	SSF47095	8.12E-10	83	137	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	9.5E-7	88	138	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 192 aa Download sequence Send to blast
MVSVPCSSLS MVVTVRCGHC TNLLSVNMLK ASFIPFHLLA SLSHLEPKES SPEEDANKTL 60 NSHSASMMTY SDCEEEDIIP MSHHVVNKPP EKRQRTPSAY NCFIKEEIKR LKAENPEMTH 120 KEAFSTAAKN WANFPQTQWC KGDEERCSQT EKLVDLDSLV DPADAEVNEE VQGFRGRKVP 180 RNSILETTQF E*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First detected in a group of around 15 epidermal cells on the abaxial half of each ovule primordium (chalaza, outer integument initiation sites). Later present in the outer cell layer of the outer integument on the abaxial side of the ovule primordium. Confined to the chalazal end of the integument and disappears after anthesis. Also present in embryos at the globular stage. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.

Functional Description ? help Back to Top
Source	Description
UniProt	Essential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:9093862, ECO:0000269\|PubMed:9118807}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.06G096500.2.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269\|PubMed:10601041, ECO:0000269\|PubMed:12183380, ECO:0000269\|PubMed:12183381}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015043	3e-42	AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006581506.1	1e-142	transcription factor YABBY8 isoform X1
Refseq	XP_006581507.1	1e-142	transcription factor YABBY8 isoform X1
Swissprot	Q9LDT3	2e-49	YAB4_ARATH; Axial regulator YABBY 4
TrEMBL	A0A0R0JMN4	1e-140	A0A0R0JMN4_SOYBN; Uncharacterized protein
STRING	GLYMA06G10110.2	1e-140	(Glycine max)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23420.1	8e-52	YABBY family protein

Link Out ? help Back to Top
Phytozome	Glyma.06G096500.2.p
Entrez Gene	100779415

Publications ? help Back to Top
Lora J,Hormaza JI,Herrero M Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT). New Phytol., 2015. 208(2): p. 584-95 [PMID:25991552] Skinner DJ,Brown RH,Kuzoff RK,Gasser CS Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function. BMC Plant Biol., 2016. 16(1): p. 143 [PMID:27350128] Simon MK,Skinner DJ,Gallagher TL,Gasser CS Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors. Genetics, 2017. 207(4): p. 1489-1500 [PMID:28971961]