PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.05G183200.1.p | ||||||||
Common Name | GLYMA_05G183200, LOC100810059 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 226aa MW: 24659.5 Da PI: 7.6212 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.8 | 4.8e-56 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 +eqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk yl++yr Glyma.05G183200.1.p 28 KEQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKFYLNNYR 117 89**************************************************************************************** PP NF-YB 92 elegek 97 e+egek Glyma.05G183200.1.p 118 ETEGEK 123 ***997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.0E-54 | 23 | 137 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.09E-40 | 30 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-27 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.2E-18 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.2E-18 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 6.2E-18 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MTGKRNQITT SPVGSPTSGN ISDSSSSKEQ DRFLPIANVS RIMKRALPAN AKISKEAKET 60 VQECVSEFIS FITGEASDKC QREKRKTING DDLLWAMTTL GFENYVGPLK FYLNNYRETE 120 GEKSSMAKQE EHSPTHQTNI DGVVVEINKL HHSVAATNKA ADFNTFSGGG FYSVGPQVAA 180 PKSFTEIGGI NGYRESSIAQ SAVSGDHDAS GNRMMPPNLR YRVEW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-47 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-47 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, culms, nodes, leaf blades, leaf sheaths and young panicles. {ECO:0000269|PubMed:20566706}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:20566706, ECO:0000269|PubMed:21148627}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.05G183200.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 0.0 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003524282.1 | 1e-169 | nuclear transcription factor Y subunit B-2-like | ||||
Swissprot | Q0J7P4 | 2e-61 | HD5_ORYSJ; Nuclear transcription factor Y subunit B-11 | ||||
TrEMBL | K7KR11 | 1e-168 | K7KR11_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA05G31681.1 | 1e-169 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-64 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.05G183200.1.p |
Entrez Gene | 100810059 |
Publications ? help Back to Top | |||
---|---|---|---|
|