PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.03G231100.1.p | ||||||||
Common Name | GLYMA_03G231100, LOC100814830 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 308aa MW: 35332.1 Da PI: 5.665 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 27.1 | 6.9e-09 | 253 | 286 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ee+ +L++ +gL+++q+ +WF N+R ++ Glyma.03G231100.1.p 253 WPYPTEEEKVKLSEITGLDQKQINNWFINQRKRH 286 58*****************************885 PP | |||||||
2 | ELK | 30 | 1.2e-10 | 206 | 227 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK++LlrKYsg+ ++L++EF+ Glyma.03G231100.1.p 206 RLKEMLLRKYSGHFSGLRKEFL 227 69*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 4.7E-21 | 60 | 104 | IPR005540 | KNOX1 |
Pfam | PF03790 | 5.6E-21 | 62 | 103 | IPR005540 | KNOX1 |
SMART | SM01256 | 6.9E-23 | 107 | 158 | IPR005541 | KNOX2 |
Pfam | PF03791 | 3.7E-22 | 111 | 157 | IPR005541 | KNOX2 |
PROSITE profile | PS51213 | 9.62 | 206 | 226 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.1E-8 | 206 | 227 | IPR005539 | ELK domain |
SMART | SM01188 | 3.7E-5 | 206 | 227 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.503 | 226 | 289 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 7.7E-19 | 228 | 298 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.2E-13 | 228 | 293 | IPR001356 | Homeobox domain |
CDD | cd00086 | 4.95E-13 | 229 | 289 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.6E-26 | 231 | 290 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 5.1E-16 | 246 | 285 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 264 | 287 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 308 aa Download sequence Send to blast |
MEAVYRLKPL LPCLEEEVVR VGNATTSEMR VGSTANCCYL QLEAPQQNNV TESSSDMSDR 60 MIKIQIANHP LYPDLLSAYI ECQKVGAPPE LACLLEEIGR ESHRMNARRE IVEGPELDHF 120 METFCEVLHR YKEELSRPFN EATLFLGDME SQLSNLCNGT LTKSSDNNNR SDEVASGASE 180 EELSCGEMEA FEDHVSSSVT CPSDQRLKEM LLRKYSGHFS GLRKEFLKRR KKGKLPKDAR 240 IALMDWWNTH HRWPYPTEEE KVKLSEITGL DQKQINNWFI NQRKRHWKPT DDMRSAVMDG 300 IRGPMLF* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.36070 | 0.0 | epicotyl| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.03G231100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT095974 | 0.0 | BT095974.1 Soybean clone JCVI-FLGm-20M5 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003520792.1 | 0.0 | homeobox protein knotted-1-like 1 isoform X1 | ||||
Refseq | XP_006577210.1 | 0.0 | homeobox protein knotted-1-like 1 isoform X1 | ||||
Refseq | XP_006577211.1 | 0.0 | homeobox protein knotted-1-like 1 isoform X1 | ||||
Refseq | XP_006577212.1 | 0.0 | homeobox protein knotted-1-like 1 isoform X1 | ||||
Refseq | XP_028226477.1 | 0.0 | homeobox protein knotted-1-like 1 | ||||
Refseq | XP_028226478.1 | 0.0 | homeobox protein knotted-1-like 1 | ||||
Refseq | XP_028226479.1 | 0.0 | homeobox protein knotted-1-like 1 | ||||
Refseq | XP_028226480.1 | 0.0 | homeobox protein knotted-1-like 1 | ||||
Swissprot | Q9FP29 | 2e-87 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
TrEMBL | A0A445LFY4 | 0.0 | A0A445LFY4_GLYSO; Homeobox protein knotted-1-like 1 isoform A | ||||
TrEMBL | K7KGK3 | 0.0 | K7KGK3_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA03G39041.2 | 0.0 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 | Representative plant | OGRP167 | 17 | 148 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 6e-84 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.03G231100.1.p |
Entrez Gene | 100814830 |
Publications ? help Back to Top | |||
---|---|---|---|
|