PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr6P02820_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

NF-YB

Protein Properties

Length: 169aa MW: 18731.8 Da PI: 7.6258

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr6P02820_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	178.7	5.3e-56	33	128	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 +eqdrflP+anvsrimk+ lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGf+ yv plk+yl+k GSMUA_Achr6P02820_001 33 KEQDRFLPVANVSRIMKRSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFDSYVGPLKAYLNK 120 79************************************************************************************ PP NF-YB 90 yrelegek 97 yre+egek GSMUA_Achr6P02820_001 121 YRETEGEK 128 ****97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.0E-52	29	134	IPR009072	Histone-fold
SuperFamily	SSF47113	3.73E-40	35	142	IPR009072	Histone-fold
Pfam	PF00808	8.1E-27	38	102	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.2E-19	66	84	No hit	No description
PROSITE pattern	PS00685	0	69	85	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.2E-19	85	103	No hit	No description
PRINTS	PR00615	2.2E-19	104	122	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MKGRRSRHHL GTGGSHQLVS DDESGHASDS SPKEQDRFLP VANVSRIMKR SLPANAKISK 60 EAKETVQECV SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFDSY VGPLKAYLNK 120 YRETEGEKNL MARHGEPPSN EPDDASPAIP SFAASGFYSV GEAWDQRKK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-46	33	123	2	92	Transcription factor HapC (Eurofung)
4g92_B	1e-46	33	123	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269\|PubMed:20566706, ECO:0000269\|PubMed:21148627}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269\|PubMed:26542958}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB124648	7e-92	AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath.
GenBank	AB124649	7e-92	AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath.
GenBank	AY062182	7e-92	AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds.
GenBank	CP012616	7e-92	CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBank	CT837794	7e-92	CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence.
GenBank	KR815350	7e-92	KR815350.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds.
GenBank	KR815351	7e-92	KR815351.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds.
GenBank	LC016712	7e-92	LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong.
GenBank	LC016713	7e-92	LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3.
GenBank	LC016714	7e-92	LC016714.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Muha.
GenBank	LC016715	7e-92	LC016715.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Basilanon.
GenBank	LC016716	7e-92	LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai.
GenBank	LC016718	7e-92	LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba.
GenBank	LC016719	7e-92	LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe.
GenBank	LC016721	7e-92	LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009403188.1	1e-125	PREDICTED: nuclear transcription factor Y subunit B-3-like
Swissprot	Q0J7P4	1e-61	HD5_ORYSJ; Nuclear transcription factor Y subunit B-11
TrEMBL	M0T3N0	1e-124	M0T3N0_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr6P02820_001	1e-124	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP201	38	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	6e-64	nuclear factor Y, subunit B3

Publications ? help Back to Top
Yan WH, et al. A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice. Mol Plant, 2011. 4(2): p. 319-30 [PMID:21148627] Dai X, et al. LHD1, an allele of DTH8/Ghd8, controls late heading date in common wild rice (Oryza rufipogon). J Integr Plant Biol, 2012. 54(10): p. 790-9 [PMID:22963226] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958]