PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr5P17480_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 161aa MW: 17665.4 Da PI: 5.3176 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.9 | 8.1e-55 | 30 | 125 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easd+c++ekrkt+ngdd++wal+tlGf+dy+ep++ yl+k GSMUA_Achr5P17480_001 30 KEQDRLLPIANVGRIMKQMLPPNAKISKEAKETMQECVSEFISFVTAEASDRCHKEKRKTVNGDDICWALGTLGFDDYAEPMRRYLHK 117 89************************************************************************************** PP NF-YB 90 yrelegek 97 yre+eg++ GSMUA_Achr5P17480_001 118 YREVEGDR 125 ******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-52 | 27 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.79E-40 | 32 | 142 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.3E-28 | 35 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.1E-19 | 63 | 81 | No hit | No description |
PRINTS | PR00615 | 6.1E-19 | 82 | 100 | No hit | No description |
PRINTS | PR00615 | 6.1E-19 | 101 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MADSSGNSQE AQGQALGTST GAGSGDGGIK EQDRLLPIAN VGRIMKQMLP PNAKISKEAK 60 ETMQECVSEF ISFVTAEASD RCHKEKRKTV NGDDICWALG TLGFDDYAEP MRRYLHKYRE 120 VEGDRSASNG QNTRSSNFGT GDGQTLFDDM DRNNPSTSRR Y |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-45 | 29 | 120 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-45 | 29 | 120 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009401183.1 | 1e-119 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O82248 | 1e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | M0SZC7 | 1e-117 | M0SZC7_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr5P17480_001 | 1e-118 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-59 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|