PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr4P27850_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 193aa MW: 20380.6 Da PI: 6.7949 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.2 | 1e-57 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl++ GSMUA_Achr4P27850_001 28 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQR 115 89************************************************************************************** PP NF-YB 90 yrelegek 97 +re+egek GSMUA_Achr4P27850_001 116 FRETEGEK 123 ******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.4E-54 | 25 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.99E-40 | 30 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.4E-28 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.6E-21 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.6E-21 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 7.6E-21 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MADSDNESGG HNNSGAGLGA AGELSSLREQ DRFLPIANVS RIMKKALPAN AKISKDAKET 60 VQECVSEFIS FITGEASDKC QREKRKTING DDLLWAMTTL GFEEYVEPLK VYLQRFRETE 120 GEKGAGSSSG GAAMYGGGMT MMMGQQVYGS PPSSSPYHHH HQLAMAAKHT TGSGDGGGGS 180 STSSTGIGRQ GRI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 9e-49 | 26 | 118 | 1 | 93 | NF-YB |
4awl_B | 8e-49 | 26 | 118 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 8e-49 | 26 | 118 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
5g49_A | 1e-48 | 26 | 118 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009265 | 1e-124 | BT009265.1 Triticum aestivum clone wlk8.pk0001.e10:fis, full insert mRNA sequence. | |||
GenBank | HE996559 | 1e-124 | HE996559.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_58707. | |||
GenBank | HM777005 | 1e-124 | HM777005.1 Triticum aestivum cultivar Babax NF-YB3 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009397767.1 | 1e-108 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 2e-74 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | M0SSP7 | 1e-140 | M0SSP7_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr4P27850_001 | 1e-141 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 8e-67 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|