PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr2P13670_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 167aa MW: 18789.9 Da PI: 6.9497 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 182.1 | 4.7e-57 | 26 | 121 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 re+drflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplkvyl++ GSMUA_Achr2P13670_001 26 REHDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYAEPLKVYLQR 113 799************************************************************************************* PP NF-YB 90 yrelegek 97 +re+egek GSMUA_Achr2P13670_001 114 FREMEGEK 121 ******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.8E-54 | 23 | 134 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.07E-41 | 29 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.0E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.0E-21 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.0E-21 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 6.0E-21 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MADSDNESGG QNHSNTGAAG ELSSPREHDR FLPIANVSRI MKKALPANAK ISKDAKETVQ 60 ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF EEYAEPLKVY LQRFREMEGE 120 KSGGSSSLSQ PQQKDGGGGH GERQWRRWWE LIFFHRDRKA RQGLIDG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-46 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-46 | 26 | 116 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009265 | 1e-122 | BT009265.1 Triticum aestivum clone wlk8.pk0001.e10:fis, full insert mRNA sequence. | |||
GenBank | HE996559 | 1e-122 | HE996559.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_58707. | |||
GenBank | HM777005 | 1e-122 | HM777005.1 Triticum aestivum cultivar Babax NF-YB3 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009388900.1 | 3e-99 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q75IZ7 | 9e-71 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | M0S7Q8 | 1e-121 | M0S7Q8_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr2P13670_001 | 1e-122 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-66 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|