PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr11P05710_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

NF-YB

Protein Properties

Length: 166aa MW: 18053 Da PI: 6.3545

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr11P05710_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	180.1	1.9e-56	27	123	1	97
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 v+eqdr+lPianv+rimk++lP+nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal tlGf+dyvep+k yl GSMUA_Achr11P05710_001 27 VKEQDRLLPIANVGRIMKQILPQNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALNTLGFDDYVEPMKRYL 113 58*********************************************************************************** PP NF-YB 88 kkyrelegek 97 +kyre+eg++ GSMUA_Achr11P05710_001 114 QKYREMEGDR 123 ******97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	4.5E-54	24	140	IPR009072	Histone-fold
SuperFamily	SSF47113	4.49E-41	30	140	IPR009072	Histone-fold
Pfam	PF00808	5.8E-28	33	97	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.6E-20	61	79	No hit	No description
PROSITE pattern	PS00685	0	64	80	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.6E-20	80	98	No hit	No description
PRINTS	PR00615	1.6E-20	99	117	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 166 aa Download sequence Send to blast
MADNLGSSME SDGHHNYAGA ASGDGGVKEQ DRLLPIANVG RIMKQILPQN AKISKEAKET 60 MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDICWALNTL GFDDYVEPMK RYLQKYREME 120 GDRAAGGGGH STKASSSSDA RDQPSAGAHF MFDPSERSKP SASRGF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-45	27	118	1	92	Transcription factor HapC (Eurofung)
4g92_B	3e-45	27	118	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU970198	9e-82	EU970198.1 Zea mays clone 342117 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009382552.1	1e-122	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	O82248	6e-57	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
Swissprot	Q75IZ7	4e-56	NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBL	M0RPQ1	1e-121	M0RPQ1_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr11P05710_001	1e-122	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2917	38	87

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-59	nuclear factor Y, subunit B5

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]