PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00138127001 | ||||||||
Common Name | GSBRNA2T00138127001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 103aa MW: 12266 Da PI: 10.4987 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 95.5 | 3.7e-30 | 22 | 78 | 6 | 62 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 + cprC+s+ntkfCyynnys+sqPry +CrryWt G alrn+P+ g+ rk k+++ GSBRNA2T00138127001 22 RVCPRCNSKNTKFCYYNNYSVSQPRYKYNNCRRYWTDGRALRNIPIFGSGRKIKRTQ 78 67********************************************99999999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 5.0E-18 | 20 | 76 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 24.064 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.3E-26 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MENLNVCVKR HTQLNEEKLP LRVCPRCNSK NTKFCYYNNY SVSQPRYKYN NCRRYWTDGR 60 ALRNIPIFGS GRKIKRTQRD QPSVEIQQVN HHQPFSHVPK NQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00138127001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009137161.1 | 6e-43 | PREDICTED: dof zinc finger protein DOF4.4-like | ||||
Refseq | XP_013670317.1 | 6e-43 | dof zinc finger protein DOF4.4-like | ||||
Refseq | XP_013741408.1 | 6e-43 | dof zinc finger protein DOF4.4-like | ||||
Swissprot | Q9SUA9 | 6e-30 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
TrEMBL | A0A0D3A4R0 | 6e-70 | A0A0D3A4R0_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6G419 | 6e-70 | A0A3P6G419_BRAOL; Uncharacterized protein | ||||
STRING | Bo1g023790.1 | 1e-70 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1602 | 17 | 89 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21050.1 | 3e-32 | Dof-type zinc finger domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|