PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00131559001 | ||||||||
Common Name | GSBRNA2T00131559001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 101aa MW: 11982.5 Da PI: 9.6569 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 77.4 | 1.8e-24 | 22 | 59 | 6 | 43 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkG 43 + cprC+s+ntkfCyynnys+sqPry Ck+Crr+Wt G GSBRNA2T00131559001 22 RVCPRCNSRNTKFCYYNNYSVSQPRYKCKNCRRHWTDG 59 67**********************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-13 | 20 | 59 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.8E-22 | 22 | 59 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 20.188 | 22 | 77 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MENLNVCVKG HTQLNEEKLP LRVCPRCNSR NTKFCYYNNY SVSQPRYKCK NCRRHWTDGH 60 GRIWGQPNET LTSRTQRDQP FVEIQQVNHH QPFSHVQKIQ * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00131559001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009137161.1 | 5e-34 | PREDICTED: dof zinc finger protein DOF4.4-like | ||||
Refseq | XP_013741408.1 | 4e-34 | dof zinc finger protein DOF4.4-like | ||||
Swissprot | Q9SUA9 | 1e-19 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
TrEMBL | A0A3P5Z3P0 | 2e-61 | A0A3P5Z3P0_BRACM; Uncharacterized protein | ||||
STRING | Bo1g023790.1 | 2e-47 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1602 | 17 | 89 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21050.1 | 4e-22 | Dof-type zinc finger domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|