PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00113855001 | ||||||||
Common Name | GSBRNA2T00113855001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 134aa MW: 15341.6 Da PI: 7.9627 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 40.1 | 4.7e-13 | 1 | 31 | 21 | 51 |
HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51 +KKA ELSvLCd+ + +iifs+++kly +ss GSBRNA2T00113855001 1 MKKARELSVLCDVPIGLIIFSQSDKLYFFSS 31 8**************************9986 PP | |||||||
2 | K-box | 27.4 | 1.4e-10 | 56 | 116 | 15 | 74 |
K-box 15 eslqqelakLkkeienLqreqRhl.lGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 +++++ + + +eienL+ ++ + G +L+ L++ +L + + qLe sl++ R++K+el++ GSBRNA2T00113855001 56 SYCEETKESMMREIENLKMNLQFYgGGHNLNLLTYDDLLRFQLQLECSLQNARARKQELWR 116 3444455789********98554414689*****************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 13.82 | 1 | 33 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.5E-10 | 1 | 29 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.7E-13 | 1 | 46 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 0.0046 | 1 | 32 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 7.321 | 55 | 133 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 9.3E-6 | 57 | 116 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MKKARELSVL CDVPIGLIIF SQSDKLYFFS SQSTSMEKLI MRYQMAKRSF HPDHGSYCEE 60 TKESMMREIE NLKMNLQFYG GGHNLNLLTY DDLLRFQLQL ECSLQNARAR KQELWRSASP 120 APQSDHPCSA AAL* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in bud pedicels, petals, anthers, style, ovary, seeds and embryos. {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00113855001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022546663.1 | 8e-75 | LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL63, partial | ||||
Swissprot | Q9SA07 | 5e-45 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
TrEMBL | A0A3P5YJ51 | 6e-86 | A0A3P5YJ51_BRACM; Uncharacterized protein | ||||
STRING | Bra023162.1-P | 3e-65 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16860 | 9 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31140.2 | 2e-47 | GORDITA |
Publications ? help Back to Top | |||
---|---|---|---|
|