PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00072911001 | ||||||||
Common Name | GSBRNA2T00072912001, LOC106346178 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 168aa MW: 19140.8 Da PI: 9.9386 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.7 | 2.3e-53 | 25 | 152 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 l+pGfrFhPtdeelv++yLk+kv gk++++ ++i evdiyk+ePwdL ++++++++ewyf+s dkky +g r nrat++gyWkatgk GSBRNA2T00072911001 25 LAPGFRFHPTDEELVSYYLKRKVLGKPVRF-DAIGEVDIYKHEPWDLAvfSRLRTRDQEWYFYSALDKKYGNGARMNRATNKGYWKATGK 113 579************************999.99**************8544888999********************************* PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 d+e+ + + + g+kktLvf++grap+g +t+Wvmheyrl GSBRNA2T00072911001 114 DREIRR-DVQILGMKKTLVFHSGRAPDGLRTNWVMHEYRL 152 *****9.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-56 | 19 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.257 | 25 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.4E-28 | 27 | 152 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MGRESVVAVS SPATAPGAVV AATALAPGFR FHPTDEELVS YYLKRKVLGK PVRFDAIGEV 60 DIYKHEPWDL AVFSRLRTRD QEWYFYSALD KKYGNGARMN RATNKGYWKA TGKDREIRRD 120 VQILGMKKTL VFHSGRAPDG LRTNWVMHEY RLVDYETENN GNLVVWL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-44 | 21 | 152 | 11 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.7949 | 1e-148 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in floral organs, and, at low levels, in other organs. {ECO:0000269|PubMed:25578968}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00072911001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC966753 | 0.0 | KC966753.1 Brassica napus NAC transcription factor 51 (NAC51.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009122872.1 | 1e-119 | PREDICTED: NAC domain-containing protein 53-like | ||||
Refseq | XP_013640888.1 | 1e-119 | NAC domain-containing protein 71 | ||||
Swissprot | Q9SQX9 | 1e-108 | NAC50_ARATH; NAC domain containing protein 50 | ||||
TrEMBL | A0A078HU22 | 1e-117 | A0A078HU22_BRANA; BnaA01g31670D protein | ||||
TrEMBL | A0A078HUG6 | 1e-120 | A0A078HUG6_BRANA; BnaA01g31680D protein | ||||
TrEMBL | M4EZ75 | 1e-117 | M4EZ75_BRARP; Uncharacterized protein | ||||
STRING | Bra034118.1-P | 1e-118 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1780 | 28 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10490.2 | 4e-96 | NAC domain containing protein 52 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106346178 |
Publications ? help Back to Top | |||
---|---|---|---|
|