PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | FANhyb_rscf00000534.1.g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 177aa MW: 20026.7 Da PI: 10.2875 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 104.6 | 1.3e-32 | 15 | 88 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++v++ +++++g +ktLvfy+grap g +tdW+mheyrl FANhyb_rscf00000534.1.g00007.1 15 RDMEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRKVVC-QSSVTGYRKTLVFYRGRAPLGDRTDWIMHEYRL 88 578**************************************.9999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 37.043 | 1 | 111 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.22E-37 | 13 | 111 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-16 | 18 | 88 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MFVLSIAEKS FLPRRDMEWF FFCPRDRKYP NGSRTNRATK AGYWKATGKD RKVVCQSSVT 60 GYRKTLVFYR GRAPLGDRTD WIMHEYRLND DFAQGSPGHK GVFALCRVVK KNEHTQKAND 120 CSAEPKAKTV GSTSSNGDLT STINSNETLS ISAGMSSQVN YMQYLKHGMD KLQFSGK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-31 | 16 | 117 | 70 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-31 | 16 | 117 | 70 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-31 | 16 | 117 | 70 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-31 | 16 | 117 | 70 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swm_B | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swm_C | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swm_D | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swp_A | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swp_B | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swp_C | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
3swp_D | 6e-31 | 16 | 117 | 73 | 174 | NAC domain-containing protein 19 |
4dul_A | 6e-31 | 16 | 117 | 70 | 171 | NAC domain-containing protein 19 |
4dul_B | 6e-31 | 16 | 117 | 70 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004300256.1 | 1e-112 | PREDICTED: protein ATAF2-like | ||||
Refseq | XP_011465166.1 | 1e-112 | PREDICTED: protein ATAF2-like | ||||
Swissprot | O49697 | 2e-57 | NAC71_ARATH; NAC domain-containing protein 71 | ||||
TrEMBL | A0A2P6P9V9 | 1e-104 | A0A2P6P9V9_ROSCH; Putative transcription factor NAM family | ||||
STRING | XP_004300256.1 | 1e-111 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6722 | 34 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17980.1 | 9e-60 | NAC domain containing protein 71 |
Publications ? help Back to Top | |||
---|---|---|---|
|