PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_rscf00000534.1.g00007.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

NAC

Protein Properties

Length: 177aa MW: 20026.7 Da PI: 10.2875

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_rscf00000534.1.g00007.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	104.6	1.3e-32	15	88	54	128
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ ew+fF++rd+ky++g+r+nratk+gyWkatgkd++v++ +++++g +ktLvfy+grap g +tdW+mheyrl FANhyb_rscf00000534.1.g00007.1 15 RDMEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDRKVVC-QSSVTGYRKTLVFYRGRAPLGDRTDWIMHEYRL 88 578************************************.9999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	37.043	1	111	IPR003441	NAC domain
SuperFamily	SSF101941	2.22E-37	13	111	IPR003441	NAC domain
Pfam	PF02365	1.4E-16	18	88	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MFVLSIAEKS FLPRRDMEWF FFCPRDRKYP NGSRTNRATK AGYWKATGKD RKVVCQSSVT 60 GYRKTLVFYR GRAPLGDRTD WIMHEYRLND DFAQGSPGHK GVFALCRVVK KNEHTQKAND 120 CSAEPKAKTV GSTSSNGDLT STINSNETLS ISAGMSSQVN YMQYLKHGMD KLQFSGK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	6e-31	16	117	70	171	NO APICAL MERISTEM PROTEIN
1ut4_B	6e-31	16	117	70	171	NO APICAL MERISTEM PROTEIN
1ut7_A	6e-31	16	117	70	171	NO APICAL MERISTEM PROTEIN
1ut7_B	6e-31	16	117	70	171	NO APICAL MERISTEM PROTEIN
3swm_A	6e-31	16	117	73	174	NAC domain-containing protein 19
3swm_B	6e-31	16	117	73	174	NAC domain-containing protein 19
3swm_C	6e-31	16	117	73	174	NAC domain-containing protein 19
3swm_D	6e-31	16	117	73	174	NAC domain-containing protein 19
3swp_A	6e-31	16	117	73	174	NAC domain-containing protein 19
3swp_B	6e-31	16	117	73	174	NAC domain-containing protein 19
3swp_C	6e-31	16	117	73	174	NAC domain-containing protein 19
3swp_D	6e-31	16	117	73	174	NAC domain-containing protein 19
4dul_A	6e-31	16	117	70	171	NAC domain-containing protein 19
4dul_B	6e-31	16	117	70	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269\|PubMed:21911380, ECO:0000269\|PubMed:25182467, ECO:0000269\|PubMed:27986917}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding in the flowering stem. {ECO:0000269\|PubMed:21911380}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004300256.1	1e-112	PREDICTED: protein ATAF2-like
Refseq	XP_011465166.1	1e-112	PREDICTED: protein ATAF2-like
Swissprot	O49697	2e-57	NAC71_ARATH; NAC domain-containing protein 71
TrEMBL	A0A2P6P9V9	1e-104	A0A2P6P9V9_ROSCH; Putative transcription factor NAM family
STRING	XP_004300256.1	1e-111	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6722	34	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17980.1	9e-60	NAC domain containing protein 71

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Asahina M,Satoh S Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues. J. Plant Res., 2015. 128(3): p. 381-8 [PMID:25736731] Matsuoka K, et al. Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls. Plant Cell Physiol., 2016. 57(12): p. 2620-2631 [PMID:27986917]