PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Eucgr.H00708.1.p | ||||||||
Common Name | EUGRSUZ_H00708 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 111aa MW: 12628.1 Da PI: 8.9247 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 29.5 | 2.4e-09 | 41 | 94 | 1 | 54 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrt 54 kfY +YA++vGF vr+ + ++s +g++ r++ +k+g++ ++k ++ +++ Eucgr.H00708.1.p 41 KFYIDYARRVGFVVRIMQRRRSGIDGRTLARRLGYNKQGFSPNQKGSHGPDKKP 94 6***************************************99999885444444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 4.0E-7 | 41 | 88 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MDLEEEASEN PVKGENGDQE ENAISEPYVG MEFDSEEAAR KFYIDYARRV GFVVRIMQRR 60 RSGIDGRTLA RRLGYNKQGF SPNQKGSHGP DKKPRPRIVH NNLRIAHIID * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Eucgr.H00708.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010069579.1 | 3e-64 | PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1 | ||||
TrEMBL | A0A059AVV3 | 8e-75 | A0A059AVV3_EUCGR; Uncharacterized protein | ||||
STRING | XP_010026003.1 | 5e-75 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3918 | 28 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G12850.1 | 2e-30 | FAR1 family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Eucgr.H00708.1.p |