PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS527675.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 131aa MW: 14953.9 Da PI: 10.6944 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40.7 | 5.1e-13 | 22 | 53 | 2 | 33 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLee 33 +++k++rr+++NReAAr+sR+RKk+++++Le EcS527675.10 22 RPDKVQRRLAQNREAARKSRLRKKKYVQQLES 53 789***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.6E-4 | 21 | 81 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.9E-9 | 22 | 54 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.714 | 23 | 65 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.88E-8 | 25 | 58 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.1E-7 | 25 | 62 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 28 | 43 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
YEYVSHESAE NSSSRSDQEA NRPDKVQRRL AQNREAARKS RLRKKKYVQQ LESSRLKLAQ 60 LELELGRARQ QGLFLGNGFD ATHFGFSRTV HSGSSSPKSG NCFGAYLWRP CLTLSKLKLI 120 GIFKAFYDSK H |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010063316.1 | 4e-56 | PREDICTED: transcription factor TGA1 isoform X1 | ||||
Refseq | XP_010063317.1 | 4e-56 | PREDICTED: transcription factor TGA1 isoform X1 | ||||
Refseq | XP_010063318.1 | 4e-56 | PREDICTED: transcription factor TGA1 isoform X1 | ||||
Swissprot | Q39237 | 1e-29 | TGA1_ARATH; Transcription factor TGA1 | ||||
TrEMBL | A0A059BX68 | 8e-55 | A0A059BX68_EUCGR; Uncharacterized protein | ||||
STRING | XP_010063316.1 | 1e-55 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2976 | 27 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65210.6 | 3e-31 | bZIP family protein |