PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC038724.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 57aa    MW: 6337.15 Da    PI: 4.551
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC038724.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer62.11.1e-19147957
   ZF-HD_dimer  9 ClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                  ClkNh +slG +a+DGC Efmp   +egt++ ++C AC CH nF  +e 
  EcC038724.10  1 CLKNHSVSLGNYAIDGCAEFMPR--DEGTPEFFQCIACCCHLNFNWKEI 47
                  **********************9..779****************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152317.982146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.7E-17146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-16146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-9146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
CLKNHSVSLG NYAIDGCAEF MPRDEGTPEF FQCIACCCHL NFNWKEIIAH GGSELES
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018715486.12e-22PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9SB617e-12ZHD2_ARATH; Zinc-finger homeodomain protein 2
STRINGXP_010026173.12e-21(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.19e-15homeobox protein 33
Publications ? help Back to Top
  1. Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA
    Seed tolerance to deterioration in arabidopsis is affected by virus infection.
    Plant Physiol. Biochem., 2017. 116: p. 1-8
    [PMID:28477474]