PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS62557.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 174aa MW: 19674.3 Da PI: 5.2857 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.4 | 2.4e-54 | 7 | 100 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+tsea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+vyl++yre++g EPS62557.1 7 REQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREFDG 100 89*****************************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.4E-50 | 3 | 106 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.68E-39 | 9 | 105 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.3E-26 | 12 | 76 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-17 | 40 | 58 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 43 | 59 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-17 | 59 | 77 | No hit | No description |
PRINTS | PR00615 | 1.2E-17 | 78 | 96 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
EGEFVIREQD RFMPIANVIR IMRKILPPHA KISDDAKETI QECVSEYISF ITSEANDRCQ 60 REQRKTITAE DVLWAMSKLG FDDYIEPLTV YLHRYREFDG GDRGSLRGDA LVKRMVEQSG 120 GMGFPATAAG FPHLNAYHHG YFQPPLPPPP AMNFFKDAAG PSQPSIEPFP PCND |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 4e-60 | 4 | 97 | 4 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011095910.1 | 2e-80 | nuclear transcription factor Y subunit B-6 | ||||
Swissprot | Q84W66 | 2e-60 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | S8DRX0 | 1e-127 | S8DRX0_9LAMI; Leafy cotyledon 1-like protein (Fragment) | ||||
STRING | Migut.M01443.1.p | 6e-76 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 4e-63 | nuclear factor Y, subunit B6 |