PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT30013 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 144aa MW: 15716.6 Da PI: 4.8318 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 44 | 5.5e-14 | 40 | 109 | 27 | 96 |
NF-YB 27 iskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 + kda e + fi ++++ a+d c+ kr+tin++d++ al ++ f ++vepl++ l+++r +++ EMT30013 40 VNKDAMAAFAESARIFIHYLSATANDVCKDGKRQTINAEDVFKALDEIEFPEFVEPLRTALEEFRSRNAA 109 78999************************************************************87665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.5E-31 | 10 | 138 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.15E-24 | 10 | 133 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-8 | 40 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MTEAWGEEPP KAIVRRLVKD KLARAASGGE GAEGGAEVIV NKDAMAAFAE SARIFIHYLS 60 ATANDVCKDG KRQTINAEDV FKALDEIEFP EFVEPLRTAL EEFRSRNAAR KPASGKKQSE 120 KKRKLEAVPE EQNGAAVEAN ADED |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK371068 | 1e-168 | AK371068.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2124A02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188630.1 | 6e-82 | neurofilament heavy polypeptide-like isoform X1 | ||||
Refseq | XP_020188631.1 | 3e-82 | DNA polymerase epsilon subunit 3-like isoform X2 | ||||
TrEMBL | M8C7G9 | 3e-98 | M8C7G9_AEGTA; DNA polymerase epsilon subunit 3 | ||||
STRING | EMT30013 | 5e-99 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10414 | 37 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G27470.1 | 1e-32 | nuclear factor Y, subunit B11 |