PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EMT29146 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 150aa MW: 16761.5 Da PI: 8.2237 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 89 | 4e-28 | 62 | 120 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vk +v +++dp +v++tYeg+H h EMT29146 62 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKERVGGDRDDPAYVVTTYEGTHSHV 120 59*******************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.4E-30 | 48 | 122 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.24E-25 | 54 | 122 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.587 | 57 | 122 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.7E-29 | 62 | 121 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.4E-22 | 63 | 119 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MGQMFANPSG HIHGQPVEWR PSNDILHFKT VDNELLAESA AAAERPRTER IAFRTRTEIE 60 ILDDGYKWRK YGKKSVKNSP NPRNYYRCST EGCSVKERVG GDRDDPAYVV TTYEGTHSHV 120 SPSTVYYASQ DAASGRFFVA GTHPPPGSLN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 1e-22 | 50 | 122 | 2 | 74 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KR827402 | 0.0 | KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020192531.1 | 2e-73 | probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 9e-37 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | M8CZ47 | 1e-109 | M8CZ47_AEGTA; Uncharacterized protein | ||||
STRING | EMT29146 | 1e-110 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-36 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|