PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do020566.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 147aa MW: 16504.2 Da PI: 10.6477 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 149.9 | 1.3e-46 | 14 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 lp+Gf F+Pt+eelv +yLk+k+ g ++ i++vd+ +ePwdLp k +++++ ew+fF++ d+ky+ g+r+nr t++gyWkatgkd+ + s+ Do020566.1 14 LPVGFCFRPTNEELVRHYLKPKIVGAAHPDLLLIPDVDLSACEPWDLPaKaLIRSNDPEWFFFAPLDRKYPGGHRSNRCTTAGYWKATGKDRLIRSRpA 112 799************************999888***************5345666778**************************************989 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 g+l+g+kktLvf++grap+g++t W+mheyr Do020566.1 113 GTLIGVKKTLVFHRGRAPRGHRTAWIMHEYRT 144 999***************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.81E-51 | 13 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 50.276 | 14 | 147 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.3E-25 | 15 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MPSPPPPPPP PGALPVGFCF RPTNEELVRH YLKPKIVGAA HPDLLLIPDV DLSACEPWDL 60 PAKALIRSND PEWFFFAPLD RKYPGGHRSN RCTTAGYWKA TGKDRLIRSR PAGTLIGVKK 120 TLVFHRGRAP RGHRTAWIMH EYRTAKP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swm_B | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swm_C | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swm_D | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swp_A | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swp_B | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swp_C | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
3swp_D | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do020566.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT067635 | 1e-132 | BT067635.1 Zea mays full-length cDNA clone ZM_BFc0101L24 mRNA, complete cds. | |||
GenBank | EU953263 | 1e-132 | EU953263.1 Zea mays clone 1394620 mRNA sequence. | |||
GenBank | KJ726982 | 1e-132 | KJ726982.1 Zea mays clone pUT3683 NAC transcription factor (NAC117) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004964250.1 | 2e-84 | uncharacterized protein LOC101755267 isoform X1 | ||||
Refseq | XP_004964251.1 | 2e-84 | uncharacterized protein LOC101755267 isoform X2 | ||||
Refseq | XP_025813332.1 | 3e-84 | uncharacterized protein LOC112890695 | ||||
Swissprot | F4JN35 | 1e-57 | NTL9_ARATH; Protein NTM1-like 9 | ||||
TrEMBL | A0A1E5VDL5 | 1e-102 | A0A1E5VDL5_9POAL; Protein NTM1-like 9 | ||||
STRING | Si006105m | 9e-84 | (Setaria italica) | ||||
STRING | Sb10g000101.1 | 4e-84 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13413 | 25 | 29 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35580.3 | 2e-62 | NAC transcription factor-like 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|