PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do003758.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 62aa MW: 7003.49 Da PI: 11.0765 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 68.1 | 8.5e-22 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 + en+s r vt+skRr gi KKA+ELS+LCd++ +++fs+tgk Do003758.1 10 KLENNSGRVVTYSKRRSGIVKKAKELSILCDIDLILLMFSPTGK 53 679***************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.1E-27 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-22 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 23.464 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-17 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-19 | 11 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-17 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-17 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MGRVKLKIKK LENNSGRVVT YSKRRSGIVK KAKELSILCD IDLILLMFSP TGKPTICIGE 60 RR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do003758.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021317426.1 | 6e-33 | agamous-like MADS-box protein AGL65 isoform X1 | ||||
Refseq | XP_021317427.1 | 6e-33 | agamous-like MADS-box protein AGL65 isoform X1 | ||||
Refseq | XP_021317428.1 | 4e-33 | agamous-like MADS-box protein AGL65 isoform X2 | ||||
Swissprot | Q1PFA4 | 7e-26 | AGL30_ARATH; Agamous-like MADS-box protein AGL30 | ||||
TrEMBL | A0A1E5UTZ6 | 1e-35 | A0A1E5UTZ6_9POAL; Uncharacterized protein | ||||
STRING | Sb05g025970.1 | 1e-32 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4626 | 36 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03060.1 | 3e-18 | AGAMOUS-like 30 |
Publications ? help Back to Top | |||
---|---|---|---|
|