PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_032121 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 105aa MW: 11859.4 Da PI: 8.2232 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 61 | 2.2e-19 | 13 | 51 | 21 | 59 |
-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 r+YYrCt+++Cpvkk+vers edp++v++tYeg+Hnh+ DCAR_032121 13 CRGYYRCTTQKCPVKKHVERSFEDPSIVITTYEGSHNHH 51 69************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 1.4E-10 | 1 | 52 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-15 | 12 | 53 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.1E-17 | 13 | 53 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.9E-13 | 13 | 51 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 19.152 | 14 | 53 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MLSKCIYPKF GICRGYYRCT TQKCPVKKHV ERSFEDPSIV ITTYEGSHNH HLPASLRANL 60 SIGSPSFLSP LNYPIHECYE DTNGTTRSND YLQHSLTLGP LQHF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-13 | 14 | 54 | 38 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-13 | 14 | 54 | 38 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012830503.1 | 1e-22 | PREDICTED: probable WRKY transcription factor 71 | ||||
Refseq | XP_022142261.1 | 1e-22 | probable WRKY transcription factor 71 | ||||
Refseq | XP_027088028.1 | 1e-22 | WRKY transcription factor 28-like | ||||
Refseq | XP_027185582.1 | 1e-22 | WRKY transcription factor 28-like | ||||
TrEMBL | A0A175YA78 | 7e-72 | A0A175YA78_DAUCS; Uncharacterized protein | ||||
STRING | Migut.H01387.1.p | 5e-22 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1485 | 24 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29860.1 | 2e-20 | WRKY DNA-binding protein 71 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_032121 |