PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_008025 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 137aa MW: 15842.5 Da PI: 7.1372 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 126.4 | 1.1e-39 | 53 | 129 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +Cqve C+ad+ +ak+yhrrhkvCe+h+kap +l++gl qrfCqqCsrfhel efD++krsCrr+L +hn+rrrk + DCAR_008025 53 CCQVEYCTADMGNAKSYHRRHKVCEFHAKAPDALIAGLPQRFCQQCSRFHELPEFDDSKRSCRRHLLGHNQRRRKVS 129 6*************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.0E-33 | 46 | 115 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 30.556 | 51 | 128 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 4.02E-36 | 52 | 131 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.6E-31 | 54 | 127 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MEITKQEGGK RKKEINEEEK YEDEDEQEDD NEKKKAQSYS VSKEAGGGST QACCQVEYCT 60 ADMGNAKSYH RRHKVCEFHA KAPDALIAGL PQRFCQQCSR FHELPEFDDS KRSCRRHLLG 120 HNQRRRKVSY HFQGEE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-35 | 45 | 127 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017236205.1 | 2e-97 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 2e-45 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A166F089 | 6e-96 | A0A166F089_DAUCS; Uncharacterized protein | ||||
STRING | Solyc02g077920.2.1 | 8e-48 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 6e-39 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_008025 |
Publications ? help Back to Top | |||
---|---|---|---|
|