![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.374630.1 | ||||||||
Common Name | Csa_4G159320 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 167aa MW: 18650.8 Da PI: 8.7632 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.9 | 7.3e-33 | 61 | 118 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e e+k++ +rkpylheSRh hA+rR+Rg+gGrF Cucsa.374630.1 61 EEPVYVNAKQYHGILRRRQSRAKAEVENKISRSQRKPYLHESRHLHAMRRERGCGGRF 118 69*******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.0E-34 | 59 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.139 | 60 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.2E-27 | 62 | 118 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.2E-24 | 63 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 65 | 85 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.2E-24 | 95 | 118 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MNNEHYHAST SQSELLTLSM TANTSYAYHD PSYGGLLSPF GFQTMHNSDY SRMALPLAMA 60 EEPVYVNAKQ YHGILRRRQS RAKAEVENKI SRSQRKPYLH ESRHLHAMRR ERGCGGRFLS 120 KNKKAEASSL LDDDDGEGSN ISLGSESMCN GSKCYQGSQL HLSAYI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-22 | 61 | 124 | 2 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681880 | 1e-90 | LN681880.1 Cucumis melo genomic scaffold, anchoredscaffold00058. | |||
GenBank | LN713262 | 1e-90 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004150466.1 | 1e-119 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
TrEMBL | A0A0A0KWA0 | 1e-117 | A0A0A0KWA0_CUCSA; Uncharacterized protein | ||||
STRING | XP_004154750.1 | 1e-119 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5379 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20910.1 | 3e-36 | nuclear factor Y, subunit A9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.374630.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|